PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G04760.1
Common NameT1E3_120
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 215aa    MW: 24407.1 Da    PI: 6.8071
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G04760.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.23.2e-07549346
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                      WT  Ed+ + +a  +++ g   +W++Ia  +   +++ ++++++  
      AT5G04760.1  5 QWTRSEDKMFEQALVLFPEGspnRWERIADQLH--KSAGEVREHYEV 49
                     7*******************************7..9********965 PP

2Myb_DNA-binding431.1e-13100144347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+ E++l++ + k++G+g+W++I+r +  +Rt+ q+ s+ qky
      AT5G04760.1 100 PWTENEHKLFLIGLKRYGKGDWRSISRNVVVTRTPTQVASHAQKY 144
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512948.861155IPR017930Myb domain
SMARTSM007171.8E-7253IPR001005SANT/Myb domain
SuperFamilySSF466894.95E-12459IPR009057Homeodomain-like
PfamPF002491.1E-5548IPR001005SANT/Myb domain
CDDcd001672.94E-6651No hitNo description
PROSITE profilePS5129418.26193149IPR017930Myb domain
SuperFamilySSF466892.51E-1695150IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-1696148IPR006447Myb domain, plants
SMARTSM007177.0E-997147IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-1099143IPR009057Homeodomain-like
PfamPF002491.7E-11100144IPR001005SANT/Myb domain
CDDcd001674.69E-8100145No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025195anatomypollen tube cell
PO:0025281anatomypollen
PO:0001017developmental stageM germinated pollen stage
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MASSQWTRSE DKMFEQALVL FPEGSPNRWE RIADQLHKSA GEVREHYEVL VHDVFEIDSG  60
RVDVPDYMDD SAAAAAGWDS AGQISFGSKH GESERKRGTP WTENEHKLFL IGLKRYGKGD  120
WRSISRNVVV TRTPTQVASH AQKYFLRQNS VKKERKRSSI HDITTVDATL AMPGSNMDWT  180
GQHGSPVQAP QQQQIMSEFG QQLNPGHFED FGFRM
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.685280.0floral meristem| flower| leaf| root| seed| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1865201400.0
Genevisible250858_at0.0
Expression AtlasAT5G04760-
AtGenExpressAT5G04760-
ATTED-IIAT5G04760-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00055PBM25215497Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G04760.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G04760
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0509760.0AY050976.1 Arabidopsis thaliana putative I-box binding factor (At5g04760) mRNA, complete cds.
GenBankAY0911770.0AY091177.1 Arabidopsis thaliana putative I-box binding factor (At5g04760) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_196096.11e-161duplicated SANT DNA-binding domain-containing protein
SwissprotQ8S9H71e-57DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLQ9LZ211e-161Q9LZ21_ARATH; Duplicated SANT DNA-binding domain-containing protein
STRINGAT5G04760.11e-161(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM51272750
Representative plantOGRP27517122
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  3. Truman W,de Zabala MT,Grant M
    Type III effectors orchestrate a complex interplay between transcriptional networks to modify basal defence responses during pathogenesis and resistance.
    Plant J., 2006. 46(1): p. 14-33
    [PMID:16553893]
  4. Peng M,Bi YM,Zhu T,Rothstein SJ
    Genome-wide analysis of Arabidopsis responsive transcriptome to nitrogen limitation and its regulation by the ubiquitin ligase gene NLA.
    Plant Mol. Biol., 2007. 65(6): p. 775-97
    [PMID:17885809]
  5. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  6. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]
  7. Machemer K, et al.
    Interplay of MYB factors in differential cell expansion, and consequences for tomato fruit development.
    Plant J., 2011. 68(2): p. 337-50
    [PMID:21707804]
  8. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]